PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_16874-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 258aa    MW: 28896.5 Da    PI: 6.1643
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_16874-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++ Ede+l++ + ++G g+W++++r  g++R++k+c++rw++yl
  TRIUR3_16874-P1  8 KGLWSPVEDEKLYNHIIRHGVGCWSSVPRLAGLHRCGKSCRLRWLNYL 55
                     678*******************************************97 PP

2Myb_DNA-binding49.11.3e-1561104146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++
  TRIUR3_16874-P1  61 RGSFSQQEEDHIVALHQILGNR-WSQIASRLP-GRTDNEIKNFWNS 104
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-21358IPR009057Homeodomain-like
PROSITE profilePS5129415.991355IPR017930Myb domain
SuperFamilySSF466891.13E-275102IPR009057Homeodomain-like
SMARTSM007171.1E-12757IPR001005SANT/Myb domain
PfamPF002498.7E-14855IPR001005SANT/Myb domain
CDDcd001672.26E-101155No hitNo description
PROSITE profilePS5129423.44556110IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2559110IPR009057Homeodomain-like
SMARTSM007174.2E-1360108IPR001005SANT/Myb domain
PfamPF002498.8E-1461104IPR001005SANT/Myb domain
CDDcd001672.60E-963103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGQPKLRKGL WSPVEDEKLY NHIIRHGVGC WSSVPRLAGL HRCGKSCRLR WLNYLRPDLR  60
RGSFSQQEED HIVALHQILG NRWSQIASRL PGRTDNEIKN FWNSCIKKKL RQQGIDPATQ  120
KPMGAMATAA LPDVEMEDRK ALSTVVDGGL AQKQQLVFDP FPFGGGKEGA DDDAGFGTGD  180
YSCVLGVSEN LGYGESSSNS SNWNYGGEVG NVLDGEVLDW AKAEMERQHD QLLEHKFSLP  240
CPEQSLLANF EFNLEQYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2721101108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0669461e-176KM066946.1 Triticum aestivum R2R3-MYB transcription factor (MYB86) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.11e-118PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-133MYB3_HORVU; Myb-related protein Hv33
TrEMBLM7YV040.0M7YV04_TRIUA; Myb-related protein Hv33
STRINGSi022730m1e-118(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.15e-70myb domain protein 86